PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_A07757F7A.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 393aa    MW: 40305.4 Da    PI: 8.3027
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_A07757F7A.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-3980141263
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                            keka++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  Traes_6DL_A07757F7A.2  80 KEKAINCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 141
                            7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2773128IPR003851Zinc finger, Dof-type
PfamPF027013.8E-3382138IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.90184138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361086122IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MDAAQWHQQQ GLGLVKPMEE MIMAGNPNPN PNPNGNPNPQ PAPPSGAEAQ RAPVPGPPAG  60
GAGAAAGTGS TERKAARPQK EKAINCPRCN STNTKFCYYN NYSLQQPRYF CKTCRRYWTE  120
GGSLRNVPVG GGSRKNKRSS SSVVSSAAGA VSTSGAASGT VPIGGMAAKN PKLMHEGAHD  180
LNLAFPHHHG RVLHPSEFAA FPSLESSSVC NPGGTMAANG AGGGRGMGAF SAMELLRSTG  240
CYVPMPQVQL GMPPEYAAAG FALGEFRMPL QHQQHHQQQQ QQQHQQHQQQ VQNMLGFSLD  300
TGGGGDAGGY GAGLQGAQES ATGRMLFPFE DLKPGTNAGG GGASGGDQFE HSKDQGGGGG  360
GGHETLGFWN NSMIGNGSSN DAGGGGGGGG GSW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2763570.0AJ276357.1 Hordeum vulgare mRNA for dof zinc finger protein (sed gene).
GenBankAJ3122970.0AJ312297.1 Hordeum vulgare sed gene for dof zinc finger protein, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953427.11e-132PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLW5GYD30.0W5GYD3_WHEAT; Uncharacterized protein
STRINGMLOC_60907.11e-126(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-30Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]